Protein Description: TP53 target 5
Gene Name: TP53TG5
Alternative Gene Name: C20orf10, CLG01, dJ453C12.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041375: 30%, ENSRNOG00000026215: 29%
Entrez Gene ID: 27296
Uniprot ID: Q9Y2B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TP53TG5
Alternative Gene Name: C20orf10, CLG01, dJ453C12.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041375: 30%, ENSRNOG00000026215: 29%
Entrez Gene ID: 27296
Uniprot ID: Q9Y2B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | STGDPKKKEYKEWKSQVQSGMRNKEKTSLAAMPRKEKHIEPEVPRTSRDDSLNPGVQGRQPLTEGPRVIFIKPYR |
Documents & Links for Anti TP53TG5 pAb (ATL-HPA077455 w/enhanced validation) | |
Datasheet | Anti TP53TG5 pAb (ATL-HPA077455 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TP53TG5 pAb (ATL-HPA077455 w/enhanced validation) at Atlas |
Documents & Links for Anti TP53TG5 pAb (ATL-HPA077455 w/enhanced validation) | |
Datasheet | Anti TP53TG5 pAb (ATL-HPA077455 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TP53TG5 pAb (ATL-HPA077455 w/enhanced validation) |