Anti TP53I11 pAb (ATL-HPA061276)

Atlas Antibodies

Catalog No: ATL-HPA061276-25

• 
• 

Product Description

Protein Description: tumor protein p53 inducible protein 11
Gene Name: TP53I11
Alternative Gene Name: PIG11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068735: 96%, ENSRNOG00000008738: 96%
Entrez Gene ID: 9537
Uniprot ID: O14683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREP
• Gene Sequence: PLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREP
• Gene ID - Mouse: ENSMUSG00000068735
• Gene ID - Rat: ENSRNOG00000008738
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.