Description
Product Description
Protein Description: TOX high mobility group box family member 2
Gene Name: TOX2
Alternative Gene Name: C20orf100, dJ1108D11.2, GCX-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074607: 95%, ENSRNOG00000008146: 95%
Entrez Gene ID: 84969
Uniprot ID: Q96NM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TOX2
Alternative Gene Name: C20orf100, dJ1108D11.2, GCX-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074607: 95%, ENSRNOG00000008146: 95%
Entrez Gene ID: 84969
Uniprot ID: Q96NM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HEASYHSLCHGLTPNGLLPAYSYQAMDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGR |
| Gene Sequence | HEASYHSLCHGLTPNGLLPAYSYQAMDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGR |
| Gene ID - Mouse | ENSMUSG00000074607 |
| Gene ID - Rat | ENSRNOG00000008146 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti TOX2 pAb (ATL-HPA058396) | |
| Datasheet | Anti TOX2 pAb (ATL-HPA058396) Datasheet (External Link) |
| Vendor Page | Anti TOX2 pAb (ATL-HPA058396) at Atlas Antibodies |
| Documents & Links for Anti TOX2 pAb (ATL-HPA058396) | |
| Datasheet | Anti TOX2 pAb (ATL-HPA058396) Datasheet (External Link) |
| Vendor Page | Anti TOX2 pAb (ATL-HPA058396) |