Description
Product Description
Protein Description: torsin family 2 member A
Gene Name: TOR2A
Alternative Gene Name: FLJ14771, TORP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009563: 90%, ENSRNOG00000022514: 90%
Entrez Gene ID: 27433
Uniprot ID: Q5JU69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TOR2A
Alternative Gene Name: FLJ14771, TORP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009563: 90%, ENSRNOG00000022514: 90%
Entrez Gene ID: 27433
Uniprot ID: Q5JU69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AIFIFISNTGGEQINQVALEAWRSRRDREEILLQELEPVIS |
Gene Sequence | AIFIFISNTGGEQINQVALEAWRSRRDREEILLQELEPVIS |
Gene ID - Mouse | ENSMUSG00000009563 |
Gene ID - Rat | ENSRNOG00000022514 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TOR2A pAb (ATL-HPA071229) | |
Datasheet | Anti TOR2A pAb (ATL-HPA071229) Datasheet (External Link) |
Vendor Page | Anti TOR2A pAb (ATL-HPA071229) at Atlas Antibodies |
Documents & Links for Anti TOR2A pAb (ATL-HPA071229) | |
Datasheet | Anti TOR2A pAb (ATL-HPA071229) Datasheet (External Link) |
Vendor Page | Anti TOR2A pAb (ATL-HPA071229) |