![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100679/180626/atl-hpa070991_anti-tor1aip1-pab-atl-hpa070991_62294__25017.1681136761.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: torsin 1A interacting protein 1
Gene Name: TOR1AIP1
Alternative Gene Name: FLJ13142, LAP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026466: 84%, ENSRNOG00000003946: 85%
Entrez Gene ID: 26092
Uniprot ID: Q5JTV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TOR1AIP1
Alternative Gene Name: FLJ13142, LAP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026466: 84%, ENSRNOG00000003946: 85%
Entrez Gene ID: 26092
Uniprot ID: Q5JTV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVRAI |
| Documents & Links for Anti TOR1AIP1 pAb (ATL-HPA070991) | |
| Datasheet | Anti TOR1AIP1 pAb (ATL-HPA070991) Datasheet (External Link) |
| Vendor Page | Anti TOR1AIP1 pAb (ATL-HPA070991) at Atlas |
| Documents & Links for Anti TOR1AIP1 pAb (ATL-HPA070991) | |
| Datasheet | Anti TOR1AIP1 pAb (ATL-HPA070991) Datasheet (External Link) |
| Vendor Page | Anti TOR1AIP1 pAb (ATL-HPA070991) |