Anti TOPORS pAb (ATL-HPA065661 w/enhanced validation)

Catalog No:
ATL-HPA065661-25
$303.00

Description

Product Description

Protein Description: topoisomerase I binding, arginine/serine-rich, E3 ubiquitin protein ligase
Gene Name: TOPORS
Alternative Gene Name: LUN, RP31, TP53BPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036822: 93%, ENSRNOG00000006485: 91%
Entrez Gene ID: 10210
Uniprot ID: Q9NS56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVQHIIMSNVTRYDLESQAFVSDLRPFLLNRTEHFIHEFISFARSPFNMAAFDQHANYDCPAPSYEEGSHSDSSVITISPDEAETQELDINVATVSQAPWDDETPGPSYSSSEQVHVTMSSLL
Gene Sequence IVQHIIMSNVTRYDLESQAFVSDLRPFLLNRTEHFIHEFISFARSPFNMAAFDQHANYDCPAPSYEEGSHSDSSVITISPDEAETQELDINVATVSQAPWDDETPGPSYSSSEQVHVTMSSLL
Gene ID - Mouse ENSMUSG00000036822
Gene ID - Rat ENSRNOG00000006485
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti TOPORS pAb (ATL-HPA065661 w/enhanced validation)
Datasheet Anti TOPORS pAb (ATL-HPA065661 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TOPORS pAb (ATL-HPA065661 w/enhanced validation)

Product Description

Protein Description: topoisomerase I binding, arginine/serine-rich, E3 ubiquitin protein ligase
Gene Name: TOPORS
Alternative Gene Name: LUN, RP31, TP53BPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036822: 93%, ENSRNOG00000006485: 91%
Entrez Gene ID: 10210
Uniprot ID: Q9NS56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVQHIIMSNVTRYDLESQAFVSDLRPFLLNRTEHFIHEFISFARSPFNMAAFDQHANYDCPAPSYEEGSHSDSSVITISPDEAETQELDINVATVSQAPWDDETPGPSYSSSEQVHVTMSSLL
Gene Sequence IVQHIIMSNVTRYDLESQAFVSDLRPFLLNRTEHFIHEFISFARSPFNMAAFDQHANYDCPAPSYEEGSHSDSSVITISPDEAETQELDINVATVSQAPWDDETPGPSYSSSEQVHVTMSSLL
Gene ID - Mouse ENSMUSG00000036822
Gene ID - Rat ENSRNOG00000006485
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti TOPORS pAb (ATL-HPA065661 w/enhanced validation)
Datasheet Anti TOPORS pAb (ATL-HPA065661 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TOPORS pAb (ATL-HPA065661 w/enhanced validation)