Protein Description: topoisomerase I binding, arginine/serine-rich, E3 ubiquitin protein ligase
Gene Name: TOPORS
Alternative Gene Name: LUN, RP31, TP53BPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036822: 93%, ENSRNOG00000006485: 91%
Entrez Gene ID: 10210
Uniprot ID: Q9NS56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TOPORS
Alternative Gene Name: LUN, RP31, TP53BPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036822: 93%, ENSRNOG00000006485: 91%
Entrez Gene ID: 10210
Uniprot ID: Q9NS56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | IVQHIIMSNVTRYDLESQAFVSDLRPFLLNRTEHFIHEFISFARSPFNMAAFDQHANYDCPAPSYEEGSHSDSSVITISPDEAETQELDINVATVSQAPWDDETPGPSYSSSEQVHVTMSSLL |
Documents & Links for Anti TOPORS pAb (ATL-HPA065661 w/enhanced validation) | |
Datasheet | Anti TOPORS pAb (ATL-HPA065661 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TOPORS pAb (ATL-HPA065661 w/enhanced validation) at Atlas |
Documents & Links for Anti TOPORS pAb (ATL-HPA065661 w/enhanced validation) | |
Datasheet | Anti TOPORS pAb (ATL-HPA065661 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TOPORS pAb (ATL-HPA065661 w/enhanced validation) |