Anti TOPORS pAb (ATL-HPA060640)

Atlas Antibodies

Catalog No: ATL-HPA060640-25

• 

Product Description

Protein Description: topoisomerase I binding, arginine/serine-rich, E3 ubiquitin protein ligase
Gene Name: TOPORS
Alternative Gene Name: LUN, RP31, TP53BPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036822: 85%, ENSRNOG00000006485: 86%
Entrez Gene ID: 10210
Uniprot ID: Q9NS56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGATCQIQGVQTNDDLNNDSDDSSDNCVIVGFVKPLAERTPELVELSSDSEDLGSYEKMETVKTQEQEQSYSSGDSDVSRCSSPHSVLGKDEQINKGHCDSSTRIKSKKEEKRSTSLSSPRNL
• Gene Sequence: GGATCQIQGVQTNDDLNNDSDDSSDNCVIVGFVKPLAERTPELVELSSDSEDLGSYEKMETVKTQEQEQSYSSGDSDVSRCSSPHSVLGKDEQINKGHCDSSTRIKSKKEEKRSTSLSSPRNL
• Gene ID - Mouse: ENSMUSG00000036822
• Gene ID - Rat: ENSRNOG00000006485
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.