Protein Description: DNA topoisomerase III beta
Gene Name: TOP3B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022779: 97%, ENSRNOG00000001845: 96%
Entrez Gene ID: 8940
Uniprot ID: O95985
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TOP3B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022779: 97%, ENSRNOG00000001845: 96%
Entrez Gene ID: 8940
Uniprot ID: O95985
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TIKLYKELRCPLDDFELVLWSSGSRGKSYPLCPYCYNHPPFRDMKKGMGCNECTHPSCQHSLSMLGIGQCVECESGVLVLDPTSGPKWKVACNKCNVV |
| Documents & Links for Anti TOP3B pAb (ATL-HPA072114) | |
| Datasheet | Anti TOP3B pAb (ATL-HPA072114) Datasheet (External Link) |
| Vendor Page | Anti TOP3B pAb (ATL-HPA072114) at Atlas |
| Documents & Links for Anti TOP3B pAb (ATL-HPA072114) | |
| Datasheet | Anti TOP3B pAb (ATL-HPA072114) Datasheet (External Link) |
| Vendor Page | Anti TOP3B pAb (ATL-HPA072114) |