Description
Product Description
Protein Description: topoisomerase (DNA) I, mitochondrial
Gene Name: TOP1MT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000934: 82%, ENSRNOG00000007500: 83%
Entrez Gene ID: 116447
Uniprot ID: Q969P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TOP1MT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000934: 82%, ENSRNOG00000007500: 83%
Entrez Gene ID: 116447
Uniprot ID: Q969P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GYCILDGHQEKIGNFKIEPPGLFRGRGDHPKMGMLKRRITPEDVVINCSRDSKIPEPPAGHQWKEVRSDNTVTWLAAWTESVQNSIKYIMLNPCSKLKGETAWQKFETARRLRGFVDEIRSQYRADWKSREMKTRQ |
| Gene Sequence | GYCILDGHQEKIGNFKIEPPGLFRGRGDHPKMGMLKRRITPEDVVINCSRDSKIPEPPAGHQWKEVRSDNTVTWLAAWTESVQNSIKYIMLNPCSKLKGETAWQKFETARRLRGFVDEIRSQYRADWKSREMKTRQ |
| Gene ID - Mouse | ENSMUSG00000000934 |
| Gene ID - Rat | ENSRNOG00000007500 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti TOP1MT pAb (ATL-HPA001915) | |
| Datasheet | Anti TOP1MT pAb (ATL-HPA001915) Datasheet (External Link) |
| Vendor Page | Anti TOP1MT pAb (ATL-HPA001915) at Atlas Antibodies |
| Documents & Links for Anti TOP1MT pAb (ATL-HPA001915) | |
| Datasheet | Anti TOP1MT pAb (ATL-HPA001915) Datasheet (External Link) |
| Vendor Page | Anti TOP1MT pAb (ATL-HPA001915) |
Citations
| Citations for Anti TOP1MT pAb (ATL-HPA001915) – 1 Found |
| Nicholls, Thomas J; Nadalutti, Cristina A; Motori, Elisa; Sommerville, Ewen W; Gorman, Gráinne S; Basu, Swaraj; Hoberg, Emily; Turnbull, Doug M; Chinnery, Patrick F; Larsson, Nils-Göran; Larsson, Erik; Falkenberg, Maria; Taylor, Robert W; Griffith, Jack D; Gustafsson, Claes M. Topoisomerase 3α Is Required for Decatenation and Segregation of Human mtDNA. Molecular Cell. 2018;69(1):9-23.e6. PubMed |