Description
Product Description
Protein Description: translocase of outer mitochondrial membrane 70
Gene Name: TOMM70
Alternative Gene Name: KIAA0719, Tom70, TOMM70A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022752: 98%, ENSRNOG00000001640: 98%
Entrez Gene ID: 9868
Uniprot ID: O94826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TOMM70
Alternative Gene Name: KIAA0719, Tom70, TOMM70A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022752: 98%, ENSRNOG00000001640: 98%
Entrez Gene ID: 9868
Uniprot ID: O94826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQFIKS |
Gene Sequence | YTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQFIKS |
Gene ID - Mouse | ENSMUSG00000022752 |
Gene ID - Rat | ENSRNOG00000001640 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TOMM70 pAb (ATL-HPA048020) | |
Datasheet | Anti TOMM70 pAb (ATL-HPA048020) Datasheet (External Link) |
Vendor Page | Anti TOMM70 pAb (ATL-HPA048020) at Atlas Antibodies |
Documents & Links for Anti TOMM70 pAb (ATL-HPA048020) | |
Datasheet | Anti TOMM70 pAb (ATL-HPA048020) Datasheet (External Link) |
Vendor Page | Anti TOMM70 pAb (ATL-HPA048020) |