Anti TOMM40 pAb (ATL-HPA036231)

Atlas Antibodies

Catalog No: ATL-HPA036231-25

• 
• 
• 

Product Description

Protein Description: translocase of outer mitochondrial membrane 40 homolog (yeast)
Gene Name: TOMM40
Alternative Gene Name: C19orf1, D19S1177E, PER-EC1, PEREC1, TOM40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002984: 80%, ENSRNOG00000018556: 73%
Entrez Gene ID: 10452
Uniprot ID: O96008
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQM
• Gene Sequence: FTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQM
• Gene ID - Mouse: ENSMUSG00000002984
• Gene ID - Rat: ENSRNOG00000018556
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti TOMM40 pAb (ATL-HPA036231) – 1 Found

Utsumi, Toshihiko; Matsuzaki, Kanako; Kiwado, Aya; Tanikawa, Ayane; Kikkawa, Yuki; Hosokawa, Takuro; Otsuka, Aoi; Iuchi, Yoshihito; Kobuchi, Hirotsugu; Moriya, Koko. Identification and characterization of protein N-myristoylation occurring on four human mitochondrial proteins, SAMM50, TOMM40, MIC19, and MIC25. Plos One. 13(11):e0206355.