Anti TOMM34 pAb (ATL-HPA056875 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA056875-100

• 
• 
• 

Product Description

Protein Description: translocase of outer mitochondrial membrane 34
Gene Name: TOMM34
Alternative Gene Name: HTOM34P, TOM34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018322: 85%, ENSRNOG00000029799: 89%
Entrez Gene ID: 10953
Uniprot ID: Q15785
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAG
• Gene Sequence: NVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAG
• Gene ID - Mouse: ENSMUSG00000018322
• Gene ID - Rat: ENSRNOG00000029799
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.