Protein Description: translocase of outer mitochondrial membrane 20 like
Gene Name: TOMM20L
Alternative Gene Name: UNQ9438
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021078: 58%, ENSRNOG00000054663: 60%
Entrez Gene ID: 387990
Uniprot ID: Q6UXN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TOMM20L
Alternative Gene Name: UNQ9438
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021078: 58%, ENSRNOG00000054663: 60%
Entrez Gene ID: 387990
Uniprot ID: Q6UXN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AFKRRLRDKRRAEPQKAEEQGTQLWDPTKNKKLQELFLQEVRMGELWLSRGEH |
Documents & Links for Anti TOMM20L pAb (ATL-HPA076397 w/enhanced validation) | |
Datasheet | Anti TOMM20L pAb (ATL-HPA076397 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TOMM20L pAb (ATL-HPA076397 w/enhanced validation) at Atlas |
Documents & Links for Anti TOMM20L pAb (ATL-HPA076397 w/enhanced validation) | |
Datasheet | Anti TOMM20L pAb (ATL-HPA076397 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TOMM20L pAb (ATL-HPA076397 w/enhanced validation) |