Anti TOMM20L pAb (ATL-HPA076397 w/enhanced validation)

Catalog No:
ATL-HPA076397-25
$447.00

Description

Product Description

Protein Description: translocase of outer mitochondrial membrane 20 like
Gene Name: TOMM20L
Alternative Gene Name: UNQ9438
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021078: 58%, ENSRNOG00000054663: 60%
Entrez Gene ID: 387990
Uniprot ID: Q6UXN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFKRRLRDKRRAEPQKAEEQGTQLWDPTKNKKLQELFLQEVRMGELWLSRGEH
Gene Sequence AFKRRLRDKRRAEPQKAEEQGTQLWDPTKNKKLQELFLQEVRMGELWLSRGEH
Gene ID - Mouse ENSMUSG00000021078
Gene ID - Rat ENSRNOG00000054663
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti TOMM20L pAb (ATL-HPA076397 w/enhanced validation)
Datasheet Anti TOMM20L pAb (ATL-HPA076397 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TOMM20L pAb (ATL-HPA076397 w/enhanced validation)

Product Description

Protein Description: translocase of outer mitochondrial membrane 20 like
Gene Name: TOMM20L
Alternative Gene Name: UNQ9438
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021078: 58%, ENSRNOG00000054663: 60%
Entrez Gene ID: 387990
Uniprot ID: Q6UXN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFKRRLRDKRRAEPQKAEEQGTQLWDPTKNKKLQELFLQEVRMGELWLSRGEH
Gene Sequence AFKRRLRDKRRAEPQKAEEQGTQLWDPTKNKKLQELFLQEVRMGELWLSRGEH
Gene ID - Mouse ENSMUSG00000021078
Gene ID - Rat ENSRNOG00000054663
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti TOMM20L pAb (ATL-HPA076397 w/enhanced validation)
Datasheet Anti TOMM20L pAb (ATL-HPA076397 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TOMM20L pAb (ATL-HPA076397 w/enhanced validation)