Description
Product Description
Protein Description: TOG array regulator of axonemal microtubules 2
Gene Name: TOGARAM2
Alternative Gene Name: Crescerin-2, FAM179A, FLJ43249, LOC165186
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045761: 87%, ENSRNOG00000026344: 85%
Entrez Gene ID: 165186
Uniprot ID: Q6ZUX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TOGARAM2
Alternative Gene Name: Crescerin-2, FAM179A, FLJ43249, LOC165186
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045761: 87%, ENSRNOG00000026344: 85%
Entrez Gene ID: 165186
Uniprot ID: Q6ZUX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FSNPELGLRDALQCLNSSDWQMKEKGLVSIQRLAACHSEVLTGKLHDVCLAVTGEVTNLRSKVSHLAISTLGDLFQALKKNMDQ |
Gene Sequence | FSNPELGLRDALQCLNSSDWQMKEKGLVSIQRLAACHSEVLTGKLHDVCLAVTGEVTNLRSKVSHLAISTLGDLFQALKKNMDQ |
Gene ID - Mouse | ENSMUSG00000045761 |
Gene ID - Rat | ENSRNOG00000026344 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TOGARAM2 pAb (ATL-HPA075216) | |
Datasheet | Anti TOGARAM2 pAb (ATL-HPA075216) Datasheet (External Link) |
Vendor Page | Anti TOGARAM2 pAb (ATL-HPA075216) at Atlas Antibodies |
Documents & Links for Anti TOGARAM2 pAb (ATL-HPA075216) | |
Datasheet | Anti TOGARAM2 pAb (ATL-HPA075216) Datasheet (External Link) |
Vendor Page | Anti TOGARAM2 pAb (ATL-HPA075216) |