Anti TOE1 pAb (ATL-HPA069119 w/enhanced validation)

Atlas

Catalog No: ATL-HPA069119-100

• 
• 
• 

Protein Description: target of EGR1, member 1 (nuclear)
Gene Name: TOE1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028688: 88%, ENSRNOG00000017561: 88%
Entrez Gene ID: 114034
Uniprot ID: Q96GM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: LHRAGFDAFMTGYVMAYVEVSQGPQPCSSGPWLPECHNKVYLSGKAVPLTVAKSQFSRSSKAHNQKMKLTWGS
• Gene ID - Mouse: ENSMUSG00000028688
• Gene ID - Rat: ENSMUSG00000028688
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.