Description
Product Description
Protein Description: trinucleotide repeat containing 6C
Gene Name: TNRC6C
Alternative Gene Name: FLJ20015, KIAA1582
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025571: 95%, ENSRNOG00000022395: 95%
Entrez Gene ID: 57690
Uniprot ID: Q9HCJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TNRC6C
Alternative Gene Name: FLJ20015, KIAA1582
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025571: 95%, ENSRNOG00000022395: 95%
Entrez Gene ID: 57690
Uniprot ID: Q9HCJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GGLSVKDPSQSQSRLPQWTHPNSMDNLPSAASPLEQNPSKHGAIPGGLSIGPPGKSSIDDSYGRYDLIQNSESPASPPVAVPHSWSRAKSDSDKISNGSSINWPPEFHPGV |
Gene Sequence | GGLSVKDPSQSQSRLPQWTHPNSMDNLPSAASPLEQNPSKHGAIPGGLSIGPPGKSSIDDSYGRYDLIQNSESPASPPVAVPHSWSRAKSDSDKISNGSSINWPPEFHPGV |
Gene ID - Mouse | ENSMUSG00000025571 |
Gene ID - Rat | ENSRNOG00000022395 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TNRC6C pAb (ATL-HPA062051) | |
Datasheet | Anti TNRC6C pAb (ATL-HPA062051) Datasheet (External Link) |
Vendor Page | Anti TNRC6C pAb (ATL-HPA062051) at Atlas Antibodies |
Documents & Links for Anti TNRC6C pAb (ATL-HPA062051) | |
Datasheet | Anti TNRC6C pAb (ATL-HPA062051) Datasheet (External Link) |
Vendor Page | Anti TNRC6C pAb (ATL-HPA062051) |