Protein Description: transportin 2
Gene Name: TNPO2
Alternative Gene Name: FLJ12155, IPO3, KPNB2B, TRN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031691: 94%, ENSRNOG00000003970: 97%
Entrez Gene ID: 30000
Uniprot ID: O14787
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TNPO2
Alternative Gene Name: FLJ12155, IPO3, KPNB2B, TRN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031691: 94%, ENSRNOG00000003970: 97%
Entrez Gene ID: 30000
Uniprot ID: O14787
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QDIKPRFHKSRTVTLPHEAERPDGSEDAEDDDD |
| Documents & Links for Anti TNPO2 pAb (ATL-HPA071498) | |
| Datasheet | Anti TNPO2 pAb (ATL-HPA071498) Datasheet (External Link) |
| Vendor Page | Anti TNPO2 pAb (ATL-HPA071498) at Atlas |
| Documents & Links for Anti TNPO2 pAb (ATL-HPA071498) | |
| Datasheet | Anti TNPO2 pAb (ATL-HPA071498) Datasheet (External Link) |
| Vendor Page | Anti TNPO2 pAb (ATL-HPA071498) |