Description
Product Description
Protein Description: troponin I type 2 (skeletal, fast)
Gene Name: TNNI2
Alternative Gene Name: AMCD2B, DA2B, FSSV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031097: 90%, ENSRNOG00000020276: 94%
Entrez Gene ID: 7136
Uniprot ID: P48788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TNNI2
Alternative Gene Name: AMCD2B, DA2B, FSSV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031097: 90%, ENSRNOG00000020276: 94%
Entrez Gene ID: 7136
Uniprot ID: P48788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSK |
Gene Sequence | ELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSK |
Gene ID - Mouse | ENSMUSG00000031097 |
Gene ID - Rat | ENSRNOG00000020276 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TNNI2 pAb (ATL-HPA055938 w/enhanced validation) | |
Datasheet | Anti TNNI2 pAb (ATL-HPA055938 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TNNI2 pAb (ATL-HPA055938 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti TNNI2 pAb (ATL-HPA055938 w/enhanced validation) | |
Datasheet | Anti TNNI2 pAb (ATL-HPA055938 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TNNI2 pAb (ATL-HPA055938 w/enhanced validation) |