Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation)

Catalog No:
ATL-HPA058481-25
$303.00

Description

Product Description

Protein Description: troponin C type 2 (fast)
Gene Name: TNNC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017300: 100%, ENSRNOG00000015155: 100%
Entrez Gene ID: 7125
Uniprot ID: P02585
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARSYLSEEMIAEFKAAFDMFDADGGGDISVKE
Gene Sequence ARSYLSEEMIAEFKAAFDMFDADGGGDISVKE
Gene ID - Mouse ENSMUSG00000017300
Gene ID - Rat ENSRNOG00000015155
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation)
Datasheet Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation)
Datasheet Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation)

Product Description

Protein Description: troponin C type 2 (fast)
Gene Name: TNNC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017300: 100%, ENSRNOG00000015155: 100%
Entrez Gene ID: 7125
Uniprot ID: P02585
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARSYLSEEMIAEFKAAFDMFDADGGGDISVKE
Gene Sequence ARSYLSEEMIAEFKAAFDMFDADGGGDISVKE
Gene ID - Mouse ENSMUSG00000017300
Gene ID - Rat ENSRNOG00000015155
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation)
Datasheet Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation)
Datasheet Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation)