Anti TNNC2 pAb (ATL-HPA058481 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA058481-25

• 
• 

Product Description

Protein Description: troponin C type 2 (fast)
Gene Name: TNNC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017300: 100%, ENSRNOG00000015155: 100%
Entrez Gene ID: 7125
Uniprot ID: P02585
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARSYLSEEMIAEFKAAFDMFDADGGGDISVKE
• Gene Sequence: ARSYLSEEMIAEFKAAFDMFDADGGGDISVKE
• Gene ID - Mouse: ENSMUSG00000017300
• Gene ID - Rat: ENSRNOG00000015155
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.