Description
Product Description
Protein Description: TNFAIP3 interacting protein 2
Gene Name: TNIP2
Alternative Gene Name: ABIN-2, FLIP1, KLIP, MGC4289
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059866: 79%, ENSRNOG00000013805: 82%
Entrez Gene ID: 79155
Uniprot ID: Q8NFZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TNIP2
Alternative Gene Name: ABIN-2, FLIP1, KLIP, MGC4289
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059866: 79%, ENSRNOG00000013805: 82%
Entrez Gene ID: 79155
Uniprot ID: Q8NFZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EDLNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQELAASRTARDAALERVQM |
Gene Sequence | EDLNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQELAASRTARDAALERVQM |
Gene ID - Mouse | ENSMUSG00000059866 |
Gene ID - Rat | ENSRNOG00000013805 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TNIP2 pAb (ATL-HPA063197) | |
Datasheet | Anti TNIP2 pAb (ATL-HPA063197) Datasheet (External Link) |
Vendor Page | Anti TNIP2 pAb (ATL-HPA063197) at Atlas Antibodies |
Documents & Links for Anti TNIP2 pAb (ATL-HPA063197) | |
Datasheet | Anti TNIP2 pAb (ATL-HPA063197) Datasheet (External Link) |
Vendor Page | Anti TNIP2 pAb (ATL-HPA063197) |