Anti TNFSF9 pAb (ATL-HPA059857)

Atlas Antibodies

Catalog No: ATL-HPA059857-25

• 

Product Description

Protein Description: tumor necrosis factor (ligand) superfamily, member 9
Gene Name: TNFSF9
Alternative Gene Name: 4-1BB-L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008855: 26%, ENSRNOG00000045595: 39%
Entrez Gene ID: 8744
Uniprot ID: P41273
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL
• Gene Sequence: SGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL
• Gene ID - Mouse: ENSMUSG00000008855
• Gene ID - Rat: ENSRNOG00000045595
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.