Description
Product Description
Protein Description: tumor necrosis factor receptor superfamily, member 9
Gene Name: TNFRSF9
Alternative Gene Name: 4-1BB, CD137, ILA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028965: 58%, ENSRNOG00000036942: 59%
Entrez Gene ID: 3604
Uniprot ID: Q07011
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TNFRSF9
Alternative Gene Name: 4-1BB, CD137, ILA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028965: 58%, ENSRNOG00000036942: 59%
Entrez Gene ID: 3604
Uniprot ID: Q07011
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQII |
Gene Sequence | KGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQII |
Gene ID - Mouse | ENSMUSG00000028965 |
Gene ID - Rat | ENSRNOG00000036942 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TNFRSF9 pAb (ATL-HPA071425) | |
Datasheet | Anti TNFRSF9 pAb (ATL-HPA071425) Datasheet (External Link) |
Vendor Page | Anti TNFRSF9 pAb (ATL-HPA071425) at Atlas Antibodies |
Documents & Links for Anti TNFRSF9 pAb (ATL-HPA071425) | |
Datasheet | Anti TNFRSF9 pAb (ATL-HPA071425) Datasheet (External Link) |
Vendor Page | Anti TNFRSF9 pAb (ATL-HPA071425) |