![Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to the Golgi apparatus.](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/104328/184330/atl-hpa058613_anti-tnfrsf11b-atl-hpa058613_67790__97335.1710522755.jpg?c=2 "Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to the Golgi apparatus.")
![Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to the Golgi apparatus.](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/104328/184330/atl-hpa058613_anti-tnfrsf11b-atl-hpa058613_67790__97335.1710522755.jpg?c=2 "Immunofluorescent staining of human cell line BJ [Human fibroblast] shows localization to the Golgi apparatus.")
Polyclonal Antibody against Human TNFRSF11B, Gene description: TNF receptor superfamily member 11b, Alternative Gene Names: OCIF, OPG, TR1, Validated applications: ICC, Uniprot ID: O00300, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIE |
| Documents & Links for Anti-TNFRSF11B pAb (ATL-HPA058613) | |
| Vendor Page | Anti-TNFRSF11B pAb (ATL-HPA058613) at Atlas |
| Documents & Links for Anti-TNFRSF11B pAb (ATL-HPA058613) | |
| Vendor Page | Anti-TNFRSF11B pAb (ATL-HPA058613) |