Description
Product Description
Protein Description: thioredoxin-related transmembrane protein 2
Gene Name: TMX2
Alternative Gene Name: PDIA12, TXNDC14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050043: 79%, ENSRNOG00000005308: 79%
Entrez Gene ID: 51075
Uniprot ID: Q9Y320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMX2
Alternative Gene Name: PDIA12, TXNDC14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050043: 79%, ENSRNOG00000005308: 79%
Entrez Gene ID: 51075
Uniprot ID: Q9Y320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK |
Gene Sequence | ENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK |
Gene ID - Mouse | ENSMUSG00000050043 |
Gene ID - Rat | ENSRNOG00000005308 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TMX2 pAb (ATL-HPA063763) | |
Datasheet | Anti TMX2 pAb (ATL-HPA063763) Datasheet (External Link) |
Vendor Page | Anti TMX2 pAb (ATL-HPA063763) at Atlas Antibodies |
Documents & Links for Anti TMX2 pAb (ATL-HPA063763) | |
Datasheet | Anti TMX2 pAb (ATL-HPA063763) Datasheet (External Link) |
Vendor Page | Anti TMX2 pAb (ATL-HPA063763) |