Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation)

Catalog No:
ATL-HPA072934-25
$447.00

Description

Product Description

Protein Description: transmembrane protease, serine 15
Gene Name: TMPRSS15
Alternative Gene Name: ENTK, MGC133046, PRSS7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022857: 64%, ENSRNOG00000001916: 57%
Entrez Gene ID: 5651
Uniprot ID: P98073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEK
Gene Sequence LNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEK
Gene ID - Mouse ENSMUSG00000022857
Gene ID - Rat ENSRNOG00000001916
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation)
Datasheet Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation)

Product Description

Protein Description: transmembrane protease, serine 15
Gene Name: TMPRSS15
Alternative Gene Name: ENTK, MGC133046, PRSS7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022857: 64%, ENSRNOG00000001916: 57%
Entrez Gene ID: 5651
Uniprot ID: P98073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEK
Gene Sequence LNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEK
Gene ID - Mouse ENSMUSG00000022857
Gene ID - Rat ENSRNOG00000001916
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation)
Datasheet Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation)