Protein Description: transmembrane protease, serine 15
Gene Name: TMPRSS15
Alternative Gene Name: ENTK, MGC133046, PRSS7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022857: 64%, ENSRNOG00000001916: 57%
Entrez Gene ID: 5651
Uniprot ID: P98073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMPRSS15
Alternative Gene Name: ENTK, MGC133046, PRSS7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022857: 64%, ENSRNOG00000001916: 57%
Entrez Gene ID: 5651
Uniprot ID: P98073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEK |
Documents & Links for Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation) | |
Datasheet | Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation) at Atlas |
Documents & Links for Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation) | |
Datasheet | Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TMPRSS15 pAb (ATL-HPA072934 w/enhanced validation) |