Protein Description: transmembrane serine protease 11A
Gene Name: TMPRSS11A
Alternative Gene Name: ECRG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072845: 60%, ENSRNOG00000046764: 58%
Entrez Gene ID: 339967
Uniprot ID: Q6ZMR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMPRSS11A
Alternative Gene Name: ECRG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072845: 60%, ENSRNOG00000046764: 58%
Entrez Gene ID: 339967
Uniprot ID: Q6ZMR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FIDSAWKKNYIKNQVVRLTPEEDGVKVDVIMVFQFPSTEQRAVREKKIQSILNQKIR |
| Documents & Links for Anti TMPRSS11A pAb (ATL-HPA078316) | |
| Datasheet | Anti TMPRSS11A pAb (ATL-HPA078316) Datasheet (External Link) |
| Vendor Page | Anti TMPRSS11A pAb (ATL-HPA078316) at Atlas |
| Documents & Links for Anti TMPRSS11A pAb (ATL-HPA078316) | |
| Datasheet | Anti TMPRSS11A pAb (ATL-HPA078316) Datasheet (External Link) |
| Vendor Page | Anti TMPRSS11A pAb (ATL-HPA078316) |