![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/100653/180594/atl-hpa070805_anti-tmpo-pab-atl-hpa070805_62262__77162.1681136722.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100653/180594/atl-hpa070805_anti-tmpo-pab-atl-hpa070805_62262__77162.1681136722.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: thymopoietin
Gene Name: TMPO
Alternative Gene Name: LAP2, LEMD4, TP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019961: 89%, ENSRNOG00000008797: 88%
Entrez Gene ID: 7112
Uniprot ID: P42167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMPO
Alternative Gene Name: LAP2, LEMD4, TP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019961: 89%, ENSRNOG00000008797: 88%
Entrez Gene ID: 7112
Uniprot ID: P42167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IDGPVISESTPIAETIMASSNESLVVNRVTGNFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDIL |
| Documents & Links for Anti TMPO pAb (ATL-HPA070805) | |
| Datasheet | Anti TMPO pAb (ATL-HPA070805) Datasheet (External Link) |
| Vendor Page | Anti TMPO pAb (ATL-HPA070805) at Atlas |
| Documents & Links for Anti TMPO pAb (ATL-HPA070805) | |
| Datasheet | Anti TMPO pAb (ATL-HPA070805) Datasheet (External Link) |
| Vendor Page | Anti TMPO pAb (ATL-HPA070805) |