![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101672/181822/atl-hpa076689_anti-tmem97-pab-atl-hpa076689-wenhanced-validation_63490__54316.1681138236.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: transmembrane protein 97
Gene Name: TMEM97
Alternative Gene Name: MAC30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037278: 82%, ENSRNOG00000022657: 79%
Entrez Gene ID: 27346
Uniprot ID: Q5BJF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM97
Alternative Gene Name: MAC30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037278: 82%, ENSRNOG00000022657: 79%
Entrez Gene ID: 27346
Uniprot ID: Q5BJF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQEPPAWFK |
| Documents & Links for Anti TMEM97 pAb (ATL-HPA076689 w/enhanced validation) | |
| Datasheet | Anti TMEM97 pAb (ATL-HPA076689 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TMEM97 pAb (ATL-HPA076689 w/enhanced validation) at Atlas |
| Documents & Links for Anti TMEM97 pAb (ATL-HPA076689 w/enhanced validation) | |
| Datasheet | Anti TMEM97 pAb (ATL-HPA076689 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TMEM97 pAb (ATL-HPA076689 w/enhanced validation) |