Anti TMEM92 pAb (ATL-HPA063009)

Atlas Antibodies

Catalog No: ATL-HPA063009-25

• 
• 

Product Description

Protein Description: transmembrane protein 92
Gene Name: TMEM92
Alternative Gene Name: FLJ33318
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075610: 53%, ENSRNOG00000042868: 53%
Entrez Gene ID: 162461
Uniprot ID: Q6UXU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELPSIIPPERVRVSLSAPPPPYSEVILKPSLGPTPTEPPPPYSFRPEEYTGDQ
• Gene Sequence: ELPSIIPPERVRVSLSAPPPPYSEVILKPSLGPTPTEPPPPYSFRPEEYTGDQ
• Gene ID - Mouse: ENSMUSG00000075610
• Gene ID - Rat: ENSRNOG00000042868
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.