Description
Product Description
Protein Description: transmembrane protein 8B
Gene Name: TMEM8B
Alternative Gene Name: C9orf127, NAG-5, NGX6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078716: 97%, ENSRNOG00000015664: 95%
Entrez Gene ID: 51754
Uniprot ID: A6NDV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM8B
Alternative Gene Name: C9orf127, NAG-5, NGX6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078716: 97%, ENSRNOG00000015664: 95%
Entrez Gene ID: 51754
Uniprot ID: A6NDV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVA |
| Gene Sequence | DSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVA |
| Gene ID - Mouse | ENSMUSG00000078716 |
| Gene ID - Rat | ENSRNOG00000015664 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti TMEM8B pAb (ATL-HPA062701) | |
| Datasheet | Anti TMEM8B pAb (ATL-HPA062701) Datasheet (External Link) |
| Vendor Page | Anti TMEM8B pAb (ATL-HPA062701) at Atlas Antibodies |
| Documents & Links for Anti TMEM8B pAb (ATL-HPA062701) | |
| Datasheet | Anti TMEM8B pAb (ATL-HPA062701) Datasheet (External Link) |
| Vendor Page | Anti TMEM8B pAb (ATL-HPA062701) |