Anti TMEM72 pAb (ATL-HPA062907 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062907-25

• 

Product Description

Protein Description: transmembrane protein 72
Gene Name: TMEM72
Alternative Gene Name: bA285G1.3, C10orf127, KSP37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048108: 81%, ENSRNOG00000023340: 81%
Entrez Gene ID: 643236
Uniprot ID: A0PK05
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDD
• Gene Sequence: LQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDD
• Gene ID - Mouse: ENSMUSG00000048108
• Gene ID - Rat: ENSRNOG00000023340
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.