Description
Product Description
Protein Description: transmembrane protein 72
Gene Name: TMEM72
Alternative Gene Name: bA285G1.3, C10orf127, KSP37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048108: 81%, ENSRNOG00000023340: 81%
Entrez Gene ID: 643236
Uniprot ID: A0PK05
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM72
Alternative Gene Name: bA285G1.3, C10orf127, KSP37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048108: 81%, ENSRNOG00000023340: 81%
Entrez Gene ID: 643236
Uniprot ID: A0PK05
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDD |
Gene Sequence | LQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDD |
Gene ID - Mouse | ENSMUSG00000048108 |
Gene ID - Rat | ENSRNOG00000023340 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TMEM72 pAb (ATL-HPA062907 w/enhanced validation) | |
Datasheet | Anti TMEM72 pAb (ATL-HPA062907 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TMEM72 pAb (ATL-HPA062907 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti TMEM72 pAb (ATL-HPA062907 w/enhanced validation) | |
Datasheet | Anti TMEM72 pAb (ATL-HPA062907 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TMEM72 pAb (ATL-HPA062907 w/enhanced validation) |