Anti TMEM71 pAb (ATL-HPA070655)

Atlas Antibodies

Catalog No: ATL-HPA070655-25

• 

Product Description

Protein Description: transmembrane protein 71
Gene Name: TMEM71
Alternative Gene Name: FLJ33069
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036944: 79%, ENSRNOG00000025460: 69%
Entrez Gene ID: 137835
Uniprot ID: Q6P5X7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSTPVASSSRLEREYAGELSPTCIFPSFTCDSLDGYHSFECGSIDPLTGSHYTCRRSPRLLTNGYYIWTED
• Gene Sequence: MSTPVASSSRLEREYAGELSPTCIFPSFTCDSLDGYHSFECGSIDPLTGSHYTCRRSPRLLTNGYYIWTED
• Gene ID - Mouse: ENSMUSG00000036944
• Gene ID - Rat: ENSRNOG00000025460
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.