Protein Description: transmembrane protein 70
Gene Name: TMEM70
Alternative Gene Name: FLJ20533
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025940: 71%, ENSRNOG00000006608: 71%
Entrez Gene ID: 54968
Uniprot ID: Q9BUB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM70
Alternative Gene Name: FLJ20533
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025940: 71%, ENSRNOG00000006608: 71%
Entrez Gene ID: 54968
Uniprot ID: Q9BUB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK |
| Documents & Links for Anti TMEM70 pAb (ATL-HPA023187) | |
| Datasheet | Anti TMEM70 pAb (ATL-HPA023187) Datasheet (External Link) |
| Vendor Page | Anti TMEM70 pAb (ATL-HPA023187) at Atlas |
| Documents & Links for Anti TMEM70 pAb (ATL-HPA023187) | |
| Datasheet | Anti TMEM70 pAb (ATL-HPA023187) Datasheet (External Link) |
| Vendor Page | Anti TMEM70 pAb (ATL-HPA023187) |