Description
Product Description
Protein Description: transmembrane protein 59-like
Gene Name: TMEM59L
Alternative Gene Name: BSMAP, C19orf4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035964: 66%, ENSRNOG00000022432: 66%
Entrez Gene ID: 25789
Uniprot ID: Q9UK28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM59L
Alternative Gene Name: BSMAP, C19orf4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035964: 66%, ENSRNOG00000022432: 66%
Entrez Gene ID: 25789
Uniprot ID: Q9UK28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SARDPFAPQLGDTQNCQLRCRDRDLGPQPSQAGLEGASESPYDRAVLISACER |
Gene Sequence | SARDPFAPQLGDTQNCQLRCRDRDLGPQPSQAGLEGASESPYDRAVLISACER |
Gene ID - Mouse | ENSMUSG00000035964 |
Gene ID - Rat | ENSRNOG00000022432 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TMEM59L pAb (ATL-HPA070701) | |
Datasheet | Anti TMEM59L pAb (ATL-HPA070701) Datasheet (External Link) |
Vendor Page | Anti TMEM59L pAb (ATL-HPA070701) at Atlas Antibodies |
Documents & Links for Anti TMEM59L pAb (ATL-HPA070701) | |
Datasheet | Anti TMEM59L pAb (ATL-HPA070701) Datasheet (External Link) |
Vendor Page | Anti TMEM59L pAb (ATL-HPA070701) |