Anti TMEM54 pAb (ATL-HPA061992)

Atlas Antibodies

Catalog No: ATL-HPA061992-25

• 

Product Description

Protein Description: transmembrane protein 54
Gene Name: TMEM54
Alternative Gene Name: CAC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028786: 76%, ENSRNOG00000024259: 73%
Entrez Gene ID: 113452
Uniprot ID: Q969K7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IAMTFATQGKALLAACTFGSSELLALAPDCPFD
• Gene Sequence: IAMTFATQGKALLAACTFGSSELLALAPDCPFD
• Gene ID - Mouse: ENSMUSG00000028786
• Gene ID - Rat: ENSRNOG00000024259
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.