Description
Product Description
Protein Description: transmembrane protein 54
Gene Name: TMEM54
Alternative Gene Name: CAC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028786: 76%, ENSRNOG00000024259: 73%
Entrez Gene ID: 113452
Uniprot ID: Q969K7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM54
Alternative Gene Name: CAC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028786: 76%, ENSRNOG00000024259: 73%
Entrez Gene ID: 113452
Uniprot ID: Q969K7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IAMTFATQGKALLAACTFGSSELLALAPDCPFD |
Gene Sequence | IAMTFATQGKALLAACTFGSSELLALAPDCPFD |
Gene ID - Mouse | ENSMUSG00000028786 |
Gene ID - Rat | ENSRNOG00000024259 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TMEM54 pAb (ATL-HPA061992) | |
Datasheet | Anti TMEM54 pAb (ATL-HPA061992) Datasheet (External Link) |
Vendor Page | Anti TMEM54 pAb (ATL-HPA061992) at Atlas Antibodies |
Documents & Links for Anti TMEM54 pAb (ATL-HPA061992) | |
Datasheet | Anti TMEM54 pAb (ATL-HPA061992) Datasheet (External Link) |
Vendor Page | Anti TMEM54 pAb (ATL-HPA061992) |