Protein Description: transmembrane protein 5
Gene Name: TMEM5
Alternative Gene Name: HP10481
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034620: 82%, ENSRNOG00000004421: 81%
Entrez Gene ID: 10329
Uniprot ID: Q9Y2B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM5
Alternative Gene Name: HP10481
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034620: 82%, ENSRNOG00000004421: 81%
Entrez Gene ID: 10329
Uniprot ID: Q9Y2B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SEEWNPWEGDEKNEQQHRFKTSLQILDKSTKGKTDLSVQIWGKAAIGLYLWEHIFEGLLDPSDVTAQWREGKSIVGRTQ |
| Documents & Links for Anti TMEM5 pAb (ATL-HPA064014) | |
| Datasheet | Anti TMEM5 pAb (ATL-HPA064014) Datasheet (External Link) |
| Vendor Page | Anti TMEM5 pAb (ATL-HPA064014) at Atlas |
| Documents & Links for Anti TMEM5 pAb (ATL-HPA064014) | |
| Datasheet | Anti TMEM5 pAb (ATL-HPA064014) Datasheet (External Link) |
| Vendor Page | Anti TMEM5 pAb (ATL-HPA064014) |