Anti TMEM5 pAb (ATL-HPA064014)

Catalog No:
ATL-HPA064014-25
$395.00

Description

Product Description

Protein Description: transmembrane protein 5
Gene Name: TMEM5
Alternative Gene Name: HP10481
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034620: 82%, ENSRNOG00000004421: 81%
Entrez Gene ID: 10329
Uniprot ID: Q9Y2B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEEWNPWEGDEKNEQQHRFKTSLQILDKSTKGKTDLSVQIWGKAAIGLYLWEHIFEGLLDPSDVTAQWREGKSIVGRTQ
Gene Sequence SEEWNPWEGDEKNEQQHRFKTSLQILDKSTKGKTDLSVQIWGKAAIGLYLWEHIFEGLLDPSDVTAQWREGKSIVGRTQ
Gene ID - Mouse ENSMUSG00000034620
Gene ID - Rat ENSRNOG00000004421
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TMEM5 pAb (ATL-HPA064014)
Datasheet Anti TMEM5 pAb (ATL-HPA064014) Datasheet (External Link)
Vendor Page Anti TMEM5 pAb (ATL-HPA064014) at Atlas Antibodies

Documents & Links for Anti TMEM5 pAb (ATL-HPA064014)
Datasheet Anti TMEM5 pAb (ATL-HPA064014) Datasheet (External Link)
Vendor Page Anti TMEM5 pAb (ATL-HPA064014)

Product Description

Protein Description: transmembrane protein 5
Gene Name: TMEM5
Alternative Gene Name: HP10481
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034620: 82%, ENSRNOG00000004421: 81%
Entrez Gene ID: 10329
Uniprot ID: Q9Y2B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEEWNPWEGDEKNEQQHRFKTSLQILDKSTKGKTDLSVQIWGKAAIGLYLWEHIFEGLLDPSDVTAQWREGKSIVGRTQ
Gene Sequence SEEWNPWEGDEKNEQQHRFKTSLQILDKSTKGKTDLSVQIWGKAAIGLYLWEHIFEGLLDPSDVTAQWREGKSIVGRTQ
Gene ID - Mouse ENSMUSG00000034620
Gene ID - Rat ENSRNOG00000004421
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TMEM5 pAb (ATL-HPA064014)
Datasheet Anti TMEM5 pAb (ATL-HPA064014) Datasheet (External Link)
Vendor Page Anti TMEM5 pAb (ATL-HPA064014) at Atlas Antibodies

Documents & Links for Anti TMEM5 pAb (ATL-HPA064014)
Datasheet Anti TMEM5 pAb (ATL-HPA064014) Datasheet (External Link)
Vendor Page Anti TMEM5 pAb (ATL-HPA064014)