Anti TMEM41A pAb (ATL-HPA059790)

Atlas Antibodies

Catalog No: ATL-HPA059790-25

• 

Product Description

Protein Description: transmembrane protein 41A
Gene Name: TMEM41A
Alternative Gene Name: MGC15397
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022856: 82%, ENSRNOG00000046283: 84%
Entrez Gene ID: 90407
Uniprot ID: Q96HV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STRLPRGRRLGSTEEAGGRSLWFPSDLAELRELSEVLREYRKEH
• Gene Sequence: STRLPRGRRLGSTEEAGGRSLWFPSDLAELRELSEVLREYRKEH
• Gene ID - Mouse: ENSMUSG00000022856
• Gene ID - Rat: ENSRNOG00000046283
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.