Anti TMEM40 pAb (ATL-HPA073122 w/enhanced validation)

Catalog No:
ATL-HPA073122-25
$447.00

Description

Product Description

Protein Description: transmembrane protein 40
Gene Name: TMEM40
Alternative Gene Name: FLJ11036
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059900: 56%, ENSRNOG00000010430: 56%
Entrez Gene ID: 55287
Uniprot ID: Q8WWA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KAMETSASSSQPQDNSQVHRETEDVDYGETDFHKQDGKAGLFSQEQYERN
Gene Sequence KAMETSASSSQPQDNSQVHRETEDVDYGETDFHKQDGKAGLFSQEQYERN
Gene ID - Mouse ENSMUSG00000059900
Gene ID - Rat ENSRNOG00000010430
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti TMEM40 pAb (ATL-HPA073122 w/enhanced validation)
Datasheet Anti TMEM40 pAb (ATL-HPA073122 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMEM40 pAb (ATL-HPA073122 w/enhanced validation)

Product Description

Protein Description: transmembrane protein 40
Gene Name: TMEM40
Alternative Gene Name: FLJ11036
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059900: 56%, ENSRNOG00000010430: 56%
Entrez Gene ID: 55287
Uniprot ID: Q8WWA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KAMETSASSSQPQDNSQVHRETEDVDYGETDFHKQDGKAGLFSQEQYERN
Gene Sequence KAMETSASSSQPQDNSQVHRETEDVDYGETDFHKQDGKAGLFSQEQYERN
Gene ID - Mouse ENSMUSG00000059900
Gene ID - Rat ENSRNOG00000010430
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti TMEM40 pAb (ATL-HPA073122 w/enhanced validation)
Datasheet Anti TMEM40 pAb (ATL-HPA073122 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMEM40 pAb (ATL-HPA073122 w/enhanced validation)