Protein Description: transmembrane protein 33
Gene Name: TMEM33
Alternative Gene Name: FLJ10525
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037720: 91%, ENSRNOG00000002254: 94%
Entrez Gene ID: 55161
Uniprot ID: P57088
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM33
Alternative Gene Name: FLJ10525
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037720: 91%, ENSRNOG00000002254: 94%
Entrez Gene ID: 55161
Uniprot ID: P57088
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LHAATYTKKVLDARGSNSLPLLRSVLDKLSANQQ |
| Documents & Links for Anti TMEM33 pAb (ATL-HPA075863) | |
| Datasheet | Anti TMEM33 pAb (ATL-HPA075863) Datasheet (External Link) |
| Vendor Page | Anti TMEM33 pAb (ATL-HPA075863) at Atlas |
| Documents & Links for Anti TMEM33 pAb (ATL-HPA075863) | |
| Datasheet | Anti TMEM33 pAb (ATL-HPA075863) Datasheet (External Link) |
| Vendor Page | Anti TMEM33 pAb (ATL-HPA075863) |