Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation)

Catalog No:
ATL-HPA079457-25
$447.00

Description

Product Description

Protein Description: transmembrane protein 252
Gene Name: TMEM252
Alternative Gene Name: C9orf71, MGC34760
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048572: 69%, ENSRNOG00000025476: 65%
Entrez Gene ID: 169693
Uniprot ID: Q8N6L7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SNYRQVTESKGVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAE
Gene Sequence SNYRQVTESKGVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAE
Gene ID - Mouse ENSMUSG00000048572
Gene ID - Rat ENSRNOG00000025476
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation)
Datasheet Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation)

Product Description

Protein Description: transmembrane protein 252
Gene Name: TMEM252
Alternative Gene Name: C9orf71, MGC34760
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048572: 69%, ENSRNOG00000025476: 65%
Entrez Gene ID: 169693
Uniprot ID: Q8N6L7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SNYRQVTESKGVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAE
Gene Sequence SNYRQVTESKGVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAE
Gene ID - Mouse ENSMUSG00000048572
Gene ID - Rat ENSRNOG00000025476
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation)
Datasheet Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation)