Protein Description: transmembrane protein 252
Gene Name: TMEM252
Alternative Gene Name: C9orf71, MGC34760
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048572: 69%, ENSRNOG00000025476: 65%
Entrez Gene ID: 169693
Uniprot ID: Q8N6L7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM252
Alternative Gene Name: C9orf71, MGC34760
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048572: 69%, ENSRNOG00000025476: 65%
Entrez Gene ID: 169693
Uniprot ID: Q8N6L7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SNYRQVTESKGVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAE |
| Documents & Links for Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation) | |
| Datasheet | Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation) at Atlas |
| Documents & Links for Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation) | |
| Datasheet | Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation) |