Description
Product Description
Protein Description: transmembrane protein 252
Gene Name: TMEM252
Alternative Gene Name: C9orf71, MGC34760
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048572: 69%, ENSRNOG00000025476: 65%
Entrez Gene ID: 169693
Uniprot ID: Q8N6L7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM252
Alternative Gene Name: C9orf71, MGC34760
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048572: 69%, ENSRNOG00000025476: 65%
Entrez Gene ID: 169693
Uniprot ID: Q8N6L7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SNYRQVTESKGVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAE |
Gene Sequence | SNYRQVTESKGVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAE |
Gene ID - Mouse | ENSMUSG00000048572 |
Gene ID - Rat | ENSRNOG00000025476 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation) | |
Datasheet | Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation) | |
Datasheet | Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TMEM252 pAb (ATL-HPA079457 w/enhanced validation) |