Protein Description: transmembrane protein 249
Gene Name: TMEM249
Alternative Gene Name: C8orfK29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050700: 24%,
Entrez Gene ID: 340393
Uniprot ID: Q2WGJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM249
Alternative Gene Name: C8orfK29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050700: 24%,
Entrez Gene ID: 340393
Uniprot ID: Q2WGJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MPKGRAGSLPTTSIGWRFQLWFLGLTCPERHLARRLKNNSFYPFVQQEPNVFVLEYYL |
| Documents & Links for Anti TMEM249 pAb (ATL-HPA078901) | |
| Datasheet | Anti TMEM249 pAb (ATL-HPA078901) Datasheet (External Link) |
| Vendor Page | Anti TMEM249 pAb (ATL-HPA078901) at Atlas |
| Documents & Links for Anti TMEM249 pAb (ATL-HPA078901) | |
| Datasheet | Anti TMEM249 pAb (ATL-HPA078901) Datasheet (External Link) |
| Vendor Page | Anti TMEM249 pAb (ATL-HPA078901) |