Description
Product Description
Protein Description: transmembrane protein 233
Gene Name: TMEM233
Alternative Gene Name: IFITMD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079278: 71%, ENSRNOG00000053974: 71%
Entrez Gene ID: 387890
Uniprot ID: B4DJY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM233
Alternative Gene Name: IFITMD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079278: 71%, ENSRNOG00000053974: 71%
Entrez Gene ID: 387890
Uniprot ID: B4DJY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSPDFKRALDSSPEANTEDDKTEEDVPMPKNYLW |
Gene Sequence | PSPDFKRALDSSPEANTEDDKTEEDVPMPKNYLW |
Gene ID - Mouse | ENSMUSG00000079278 |
Gene ID - Rat | ENSRNOG00000053974 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TMEM233 pAb (ATL-HPA075435) | |
Datasheet | Anti TMEM233 pAb (ATL-HPA075435) Datasheet (External Link) |
Vendor Page | Anti TMEM233 pAb (ATL-HPA075435) at Atlas Antibodies |
Documents & Links for Anti TMEM233 pAb (ATL-HPA075435) | |
Datasheet | Anti TMEM233 pAb (ATL-HPA075435) Datasheet (External Link) |
Vendor Page | Anti TMEM233 pAb (ATL-HPA075435) |