Description
Product Description
Protein Description: transmembrane protein 229A
Gene Name: TMEM229A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048022: 88%, ENSRNOG00000039464: 88%
Entrez Gene ID: 730130
Uniprot ID: B2RXF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM229A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048022: 88%, ENSRNOG00000039464: 88%
Entrez Gene ID: 730130
Uniprot ID: B2RXF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SPDLRMLGFSSPYRCLLHSLTHFALEKVYLQQRRCPNAFVFNFLLYPSAHVGLQTLAGQALLLSLGG |
Gene Sequence | SPDLRMLGFSSPYRCLLHSLTHFALEKVYLQQRRCPNAFVFNFLLYPSAHVGLQTLAGQALLLSLGG |
Gene ID - Mouse | ENSMUSG00000048022 |
Gene ID - Rat | ENSRNOG00000039464 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TMEM229A pAb (ATL-HPA056391) | |
Datasheet | Anti TMEM229A pAb (ATL-HPA056391) Datasheet (External Link) |
Vendor Page | Anti TMEM229A pAb (ATL-HPA056391) at Atlas Antibodies |
Documents & Links for Anti TMEM229A pAb (ATL-HPA056391) | |
Datasheet | Anti TMEM229A pAb (ATL-HPA056391) Datasheet (External Link) |
Vendor Page | Anti TMEM229A pAb (ATL-HPA056391) |