Protein Description: transmembrane protein 221
Gene Name: TMEM221
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031326: 29%, ENSRNOG00000012991: 29%
Entrez Gene ID: 100130519
Uniprot ID: A6NGB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM221
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031326: 29%, ENSRNOG00000012991: 29%
Entrez Gene ID: 100130519
Uniprot ID: A6NGB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PGDPFGSMATATAPAALEGGWESSLPASRMHRTLSAGLGHWDGVTHEMRRMLGHRPGSTGKDSTLV |
Documents & Links for Anti TMEM221 pAb (ATL-HPA062945) | |
Datasheet | Anti TMEM221 pAb (ATL-HPA062945) Datasheet (External Link) |
Vendor Page | Anti TMEM221 pAb (ATL-HPA062945) at Atlas |
Documents & Links for Anti TMEM221 pAb (ATL-HPA062945) | |
Datasheet | Anti TMEM221 pAb (ATL-HPA062945) Datasheet (External Link) |
Vendor Page | Anti TMEM221 pAb (ATL-HPA062945) |