Protein Description: transmembrane protein 215
Gene Name: TMEM215
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046593: 94%, ENSRNOG00000042246: 94%
Entrez Gene ID: 401498
Uniprot ID: Q68D42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM215
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046593: 94%, ENSRNOG00000042246: 94%
Entrez Gene ID: 401498
Uniprot ID: Q68D42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TEGCTKWPENELLWVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGKPPPQSQGE |
Documents & Links for Anti TMEM215 pAb (ATL-HPA063207) | |
Datasheet | Anti TMEM215 pAb (ATL-HPA063207) Datasheet (External Link) |
Vendor Page | Anti TMEM215 pAb (ATL-HPA063207) at Atlas |
Documents & Links for Anti TMEM215 pAb (ATL-HPA063207) | |
Datasheet | Anti TMEM215 pAb (ATL-HPA063207) Datasheet (External Link) |
Vendor Page | Anti TMEM215 pAb (ATL-HPA063207) |