Protein Description: transmembrane protein 211
Gene Name: TMEM211
Alternative Gene Name: bA9F11.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066964: 69%, ENSRNOG00000051192: 69%
Entrez Gene ID: 255349
Uniprot ID: Q6ICI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM211
Alternative Gene Name: bA9F11.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066964: 69%, ENSRNOG00000051192: 69%
Entrez Gene ID: 255349
Uniprot ID: Q6ICI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AFSLISPAWFQTPTFSFGILTYCSWPQGNSWNQSCVTFSSLEDIPDFAWKV |
| Documents & Links for Anti TMEM211 pAb (ATL-HPA066784) | |
| Datasheet | Anti TMEM211 pAb (ATL-HPA066784) Datasheet (External Link) |
| Vendor Page | Anti TMEM211 pAb (ATL-HPA066784) at Atlas |
| Documents & Links for Anti TMEM211 pAb (ATL-HPA066784) | |
| Datasheet | Anti TMEM211 pAb (ATL-HPA066784) Datasheet (External Link) |
| Vendor Page | Anti TMEM211 pAb (ATL-HPA066784) |