Anti TMEM211 pAb (ATL-HPA066784)

Catalog No:
ATL-HPA066784-25
$447.00

Description

Product Description

Protein Description: transmembrane protein 211
Gene Name: TMEM211
Alternative Gene Name: bA9F11.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066964: 69%, ENSRNOG00000051192: 69%
Entrez Gene ID: 255349
Uniprot ID: Q6ICI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFSLISPAWFQTPTFSFGILTYCSWPQGNSWNQSCVTFSSLEDIPDFAWKV
Gene Sequence AFSLISPAWFQTPTFSFGILTYCSWPQGNSWNQSCVTFSSLEDIPDFAWKV
Gene ID - Mouse ENSMUSG00000066964
Gene ID - Rat ENSRNOG00000051192
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TMEM211 pAb (ATL-HPA066784)
Datasheet Anti TMEM211 pAb (ATL-HPA066784) Datasheet (External Link)
Vendor Page Anti TMEM211 pAb (ATL-HPA066784) at Atlas Antibodies

Documents & Links for Anti TMEM211 pAb (ATL-HPA066784)
Datasheet Anti TMEM211 pAb (ATL-HPA066784) Datasheet (External Link)
Vendor Page Anti TMEM211 pAb (ATL-HPA066784)

Product Description

Protein Description: transmembrane protein 211
Gene Name: TMEM211
Alternative Gene Name: bA9F11.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066964: 69%, ENSRNOG00000051192: 69%
Entrez Gene ID: 255349
Uniprot ID: Q6ICI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFSLISPAWFQTPTFSFGILTYCSWPQGNSWNQSCVTFSSLEDIPDFAWKV
Gene Sequence AFSLISPAWFQTPTFSFGILTYCSWPQGNSWNQSCVTFSSLEDIPDFAWKV
Gene ID - Mouse ENSMUSG00000066964
Gene ID - Rat ENSRNOG00000051192
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TMEM211 pAb (ATL-HPA066784)
Datasheet Anti TMEM211 pAb (ATL-HPA066784) Datasheet (External Link)
Vendor Page Anti TMEM211 pAb (ATL-HPA066784) at Atlas Antibodies

Documents & Links for Anti TMEM211 pAb (ATL-HPA066784)
Datasheet Anti TMEM211 pAb (ATL-HPA066784) Datasheet (External Link)
Vendor Page Anti TMEM211 pAb (ATL-HPA066784)