Description
Product Description
Protein Description: transmembrane protein 211
Gene Name: TMEM211
Alternative Gene Name: bA9F11.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066964: 69%, ENSRNOG00000051192: 69%
Entrez Gene ID: 255349
Uniprot ID: Q6ICI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM211
Alternative Gene Name: bA9F11.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066964: 69%, ENSRNOG00000051192: 69%
Entrez Gene ID: 255349
Uniprot ID: Q6ICI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AFSLISPAWFQTPTFSFGILTYCSWPQGNSWNQSCVTFSSLEDIPDFAWKV |
Gene Sequence | AFSLISPAWFQTPTFSFGILTYCSWPQGNSWNQSCVTFSSLEDIPDFAWKV |
Gene ID - Mouse | ENSMUSG00000066964 |
Gene ID - Rat | ENSRNOG00000051192 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti TMEM211 pAb (ATL-HPA066784) | |
Datasheet | Anti TMEM211 pAb (ATL-HPA066784) Datasheet (External Link) |
Vendor Page | Anti TMEM211 pAb (ATL-HPA066784) at Atlas Antibodies |
Documents & Links for Anti TMEM211 pAb (ATL-HPA066784) | |
Datasheet | Anti TMEM211 pAb (ATL-HPA066784) Datasheet (External Link) |
Vendor Page | Anti TMEM211 pAb (ATL-HPA066784) |