Protein Description: transmembrane protein 198
Gene Name: TMEM198
Alternative Gene Name: MGC99813, TMEM198A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051703: 92%, ENSRNOG00000020061: 92%
Entrez Gene ID: 130612
Uniprot ID: Q66K66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM198
Alternative Gene Name: MGC99813, TMEM198A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051703: 92%, ENSRNOG00000020061: 92%
Entrez Gene ID: 130612
Uniprot ID: Q66K66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | WRVTAEGDSHTEVVISRQRRRVQLMRIRQQEDRKEKR |
| Documents & Links for Anti TMEM198 pAb (ATL-HPA062897) | |
| Datasheet | Anti TMEM198 pAb (ATL-HPA062897) Datasheet (External Link) |
| Vendor Page | Anti TMEM198 pAb (ATL-HPA062897) at Atlas |
| Documents & Links for Anti TMEM198 pAb (ATL-HPA062897) | |
| Datasheet | Anti TMEM198 pAb (ATL-HPA062897) Datasheet (External Link) |
| Vendor Page | Anti TMEM198 pAb (ATL-HPA062897) |