Anti TMEM198 pAb (ATL-HPA062897)

Atlas Antibodies

Catalog No: ATL-HPA062897-25

• 

Product Description

Protein Description: transmembrane protein 198
Gene Name: TMEM198
Alternative Gene Name: MGC99813, TMEM198A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051703: 92%, ENSRNOG00000020061: 92%
Entrez Gene ID: 130612
Uniprot ID: Q66K66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WRVTAEGDSHTEVVISRQRRRVQLMRIRQQEDRKEKR
• Gene Sequence: WRVTAEGDSHTEVVISRQRRRVQLMRIRQQEDRKEKR
• Gene ID - Mouse: ENSMUSG00000051703
• Gene ID - Rat: ENSRNOG00000020061
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.