Description
Product Description
Protein Description: transmembrane protein 189
Gene Name: TMEM189
Alternative Gene Name: Kua
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090213: 98%, ENSRNOG00000060571: 93%
Entrez Gene ID: 387521
Uniprot ID: A5PLL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM189
Alternative Gene Name: Kua
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090213: 98%, ENSRNOG00000060571: 93%
Entrez Gene ID: 387521
Uniprot ID: A5PLL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKI |
| Gene Sequence | YFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKI |
| Gene ID - Mouse | ENSMUSG00000090213 |
| Gene ID - Rat | ENSRNOG00000060571 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti TMEM189 pAb (ATL-HPA059549) | |
| Datasheet | Anti TMEM189 pAb (ATL-HPA059549) Datasheet (External Link) |
| Vendor Page | Anti TMEM189 pAb (ATL-HPA059549) at Atlas Antibodies |
| Documents & Links for Anti TMEM189 pAb (ATL-HPA059549) | |
| Datasheet | Anti TMEM189 pAb (ATL-HPA059549) Datasheet (External Link) |
| Vendor Page | Anti TMEM189 pAb (ATL-HPA059549) |