Protein Description: transmembrane protein 186
Gene Name: TMEM186
Alternative Gene Name: C16orf51, DKFZP564K2062
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043140: 72%, ENSRNOG00000027087: 70%
Entrez Gene ID: 25880
Uniprot ID: Q96B77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM186
Alternative Gene Name: C16orf51, DKFZP564K2062
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043140: 72%, ENSRNOG00000027087: 70%
Entrez Gene ID: 25880
Uniprot ID: Q96B77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LTETKDRPQEMFVRIQRYSGKQTFYVTLRYGRILDRERFTQVFGVHQMLK |
| Documents & Links for Anti TMEM186 pAb (ATL-HPA063559) | |
| Datasheet | Anti TMEM186 pAb (ATL-HPA063559) Datasheet (External Link) |
| Vendor Page | Anti TMEM186 pAb (ATL-HPA063559) at Atlas |
| Documents & Links for Anti TMEM186 pAb (ATL-HPA063559) | |
| Datasheet | Anti TMEM186 pAb (ATL-HPA063559) Datasheet (External Link) |
| Vendor Page | Anti TMEM186 pAb (ATL-HPA063559) |