Protein Description: transmembrane protein 183A
Gene Name: TMEM183A
Alternative Gene Name: C1orf37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042305: 95%, ENSRNOG00000003594: 96%
Entrez Gene ID: 92703
Uniprot ID: Q8IXX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM183A
Alternative Gene Name: C1orf37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042305: 95%, ENSRNOG00000003594: 96%
Entrez Gene ID: 92703
Uniprot ID: Q8IXX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VAMPKRGKRLKFRAHDACSGRVTVADYANSDPAVVRSGRVKKAVANAVQQEVKSLCGLEASQVPTEEALSGAGE |
| Documents & Links for Anti TMEM183A pAb (ATL-HPA072607) | |
| Datasheet | Anti TMEM183A pAb (ATL-HPA072607) Datasheet (External Link) |
| Vendor Page | Anti TMEM183A pAb (ATL-HPA072607) at Atlas |
| Documents & Links for Anti TMEM183A pAb (ATL-HPA072607) | |
| Datasheet | Anti TMEM183A pAb (ATL-HPA072607) Datasheet (External Link) |
| Vendor Page | Anti TMEM183A pAb (ATL-HPA072607) |